PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 519aa    MW: 57855.4 Da    PI: 7.4976
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024669genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
      Lus10024669 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.54.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T++E++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
      Lus10024669  67 RGRFTPDEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466892.06E-2912108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002494.7E-151461IPR001005SANT/Myb domain
CDDcd001671.17E-111761No hitNo description
PROSITE profilePS5129425.12262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2465116IPR009057Homeodomain-like
SMARTSM007177.5E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1467111IPR001005SANT/Myb domain
CDDcd001671.38E-1169112No hitNo description
PfamPF035018.8E-43342433IPR005326Plectin/S10, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPDEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPP  120
PPSPSPPSLS SSSPLLLQTP PSIATQPPCT GSVSGATHHQ LVNITSYQTS THVLDPTHQP  180
EPGPRGTHLF PSAVQDAVFH PPPPLPSMFI FDGDHHHHHH QNQLFIEPVS GSWNDHNFHH  240
HNHNHNHPPP QQSHQPFGFL PPLFEHDGDH LVGSMEEVDQ EGTAGARTVM MNDEEWAAAV  300
DSRHEPSSGN NSFLFWEEND VVLDEGAIIR CGGDSNFTAA IISEKNRREI SKYLFQEGVC  360
YAKKDFNLAK HPDIDVPNLQ VIKLMQSFKS KEYVRETFAW MHYYWYLTNE GIEFLRAYLN  420
LPSEIVPATL KKQVKAGGRP QFGGDRPRGP PRSDGERRFG GDRDGYRSGP RAPGGDYGDK  480
GGAPADYRPT YGGSGPRAGF GRGGGSYSGG AATSSDLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v7e_BK6e-63341494215940S ribosomal protein S10E
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054774.11e-168PREDICTED: transcription factor MYB51
TrEMBLA0A0B2NS981e-153A0A0B2NS98_GLYSO; 40S ribosomal protein S10
STRINGPOPTR_0003s13190.16e-87(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-83myb domain protein 103